PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G124700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 537aa    MW: 61649.3 Da    PI: 4.6113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G124700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-17272318148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg WT eEd ll+++v ++G ++W+ Ia+++  gR +kqc++rw+++l
  Aqcoe3G124700.1.p 272 RGQWTLEEDRLLARLVDKYGLRSWSHIAQMLK-GRIGKQCRERWHNHL 318
                        89*****************************9.*************97 PP

2Myb_DNA-binding52.79.6e-17324366145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        +  WT+eEd  l++ +++lG++ W+ Ia++++ gRt++++k++w+
  Aqcoe3G124700.1.p 324 KETWTEEEDIVLIQTHAELGNK-WAEIAKRLP-GRTENSIKNHWN 366
                        578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.682267318IPR017930Myb domain
SuperFamilySSF466894.49E-31269365IPR009057Homeodomain-like
SMARTSM007171.5E-15271320IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-26273325IPR009057Homeodomain-like
CDDcd001671.51E-13275318No hitNo description
PfamPF139216.1E-18275333No hitNo description
PROSITE profilePS5129426.996319373IPR017930Myb domain
SMARTSM007172.1E-15323371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-22326371IPR009057Homeodomain-like
CDDcd001671.39E-11326369No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MEFDTNYKED VISDSTSLWE NHMEPDLLGN EFSIDECSPN GYFQDFRQFD HISIVGSSSN  60
LEFDVPSPRF ERLEAALGNK SATNFEIYES KPLVEGGDDC SMDFIGDESK PIGKEGDICS  120
NGIEKSMSKP LEGEGDECTM NFDVYESEPA IEGGKCNMNF NTYDSNTLAQ DDNCSVFDIY  180
ESKPFTKDEN RVMQNFWSSE FLNHPQGSLV PMVEQHQSEL SSNFQEIEPL NYALPDENSC  240
ITGDQTSYQE VEFDRNDALV RRRTGKGHRI PRGQWTLEED RLLARLVDKY GLRSWSHIAQ  300
MLKGRIGKQC RERWHNHLRP NIKKETWTEE EDIVLIQTHA ELGNKWAEIA KRLPGRTENS  360
IKNHWNATKR KQYTKRRSRT KGSKSTLLQN YIKSLSSNSR LADYHKNRFK SLTSYSMVSD  420
YQKNRLANAP IEFATNNTMM TELQTPHPDE SDFYASDGLD QNYNFNENLE FNYGPKMLSD  480
DCSIESILKE VSSDCGIDEG SFEVKKLEEV NSMMLTEVKK DMDLVEMISQ INVKRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-432723724104C-Myb DNA-Binding Domain
1msf_C3e-432723724104C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-75myb domain protein 98